Mouse anti-Human CD81 Monoclonal Antibody (Clone K70020_22A5)

Home/ Products / Mouse Monoclonal Abs

PRODUCT

  • SKU

    WZA4332-100ul

  • Size

    100uL

  • Price

    $650

1
This antibody was raised against a protein with Unprot Accession # P60033. It's core sequence is: KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDC
target CD81
host Mouse
gene id 975
reactivity Human
clonality Monoclonal
clone number K70020_22A5
iso type IgG1
conjugate Unconjugated
applications IHC, ICC, WB
formulation Supplied as solution in phosphate buffered saline containing 0.09% sodium azide
dilution IHC 1:250-1:500, WB 1:1000
shipping Ship at ambient conditions or with ice packs.
storage Store at 4°C. The antibody is stable for at least one month from date of shipment. For long-term storage, aliquote the antibody and store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Images

Immunohistochemistry: IHC-P analysis of tonsil tissue by CD81 antibody (K70020_22A5). IHC-P was performed using sections of the formalin-fixed paraffin-embedded tonsil tissue.

Western Blot: 15 ug of SK-MEL-28 lysate was run on 6-18% SDS-PAGE under reducing conditions and blotted onto nitrocellulose membrane. K70020_22A5 at 1 ug/mL was used as the primary antibody and peroxidase conjugated goat anti-mouse IgG was used as the secondary antibody. CD81 band was visualized using ECL Substrate. Result: K70020_22A5 can detect CD81 by Western blotting.


PRODUCT

  • SKU

    WZA4332-100ul

  • Size

    100uL

  • Price

    $650

1